PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA35156
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family NF-YB
Protein Properties Length: 171aa    MW: 19504.5 Da    PI: 5.1186
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA35156genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB170.81.6e-5333128297
                      NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkv 85 
                                +eqdr+lPianv+rimk++lP nakisk+aket+qecvsef+sfvt+easdkc++ekrkt+ngdd++wa+++lGf+dy eplk 
  Tp57577_TGAC_v2_mRNA35156  33 KEQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFVSFVTGEASDKCHKEKRKTVNGDDVCWAMTNLGFDDYSEPLKR 116
                                89********************************************************************************** PP

                      NF-YB  86 ylkkyrelegek 97 
                                yl kyre++ e+
  Tp57577_TGAC_v2_mRNA35156 117 YLYKYREFDVER 128
                                *******99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.104.2E-5327153IPR009072Histone-fold
SuperFamilySSF471132.95E-4035149IPR009072Histone-fold
PfamPF008083.1E-2738102IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.8E-196684No hitNo description
PRINTSPR006151.8E-1985103No hitNo description
PRINTSPR006151.8E-19104122No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 171 aa     Download sequence    Send to blast
MGDNNNKGKV IEEAFNYNNN NNFTSPQDHE VIKEQDRLLP IANVGRIMKQ ILPPNAKISK  60
EAKETMQECV SEFVSFVTGE ASDKCHKEKR KTVNGDDVCW AMTNLGFDDY SEPLKRYLYK  120
YREFDVERGN QSKGNNINNS DEIETYNYDD DKSQTQGTSN RNLGPKSRGF *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B1e-4532123192Transcription factor HapC (Eurofung)
4g92_B1e-4532123192Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ9182791e-110JQ918279.1 Medicago truncatula nuclear transcription factor Y subunit B6 (NF-YB6) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013469195.15e-80nuclear transcription factor Y protein
SwissprotO822481e-58NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBLI3TAW45e-80I3TAW4_MEDTR; Nuclear transcription factor Y protein
STRINGGLYMA02G17310.19e-74(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80532131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47810.11e-59nuclear factor Y, subunit B5